SCOP 1.75: Domain d1oi4b1: 1oi4 B:223-392

Lineage for d1oi4b1 (1oi4 B:223-392)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (9 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (9 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein Hypothetical protein YhbO [89601] (1 species)

7. Species Escherichia coli [TaxId:562] [89602] (1 PDB entry)

8. Domain d1oi4b1: 1oi4 B:223-392 [144365]
   structural genomics

Details for d1oi4b1

PDB Entry: 1oi4, 2.03 Å

PDB Description: crystal structure of yhbo from escherichia coli

PDB Compounds: (B:) hypothetical protein yhbo

SCOP Domain Sequences for d1oi4b1:

Sequence; same for both SEQRES and ATOM records:

>d1oi4b1 c.23.16.2 (B:223-392) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]}
skkiavlitdefedseftspadefrkaghevitiekqagktvkgkkgeasvtidksidev
tpaefdalllpgghspdylrgdnrfvtftrdfvnsgkpvfaichgpqllisadvirgrkl
tavkpiiidvknagaefydqevvvdkdqlvtsrtpddlpafnrealrllg

Timeline for d1oi4b1:

• d1oi4b1 is new in SCOP 1.75
  
• d1oi4b1 appears in SCOPe 2.01
  
• d1oi4b1 appears in the current release, SCOPe 2.08