Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (1 family) |
Family d.37.1.1: CBS-domain pair [54632] (20 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species) contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals |
Species Human (Homo sapiens), type II [TaxId:9606] [54634] (3 PDB entries) |
Domain d1b3ob4: 1b3o B:112-231 [144354] Other proteins in same PDB: d1b3oa1, d1b3ob1 complexed with cpr, sae |
PDB Entry: 1b3o (more details), 2.9 Å
SCOP Domain Sequences for d1b3ob4:
Sequence, based on SEQRES records: (download)
>d1b3ob4 d.37.1.1 (B:112-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II [TaxId: 9606]} qgfitdpvvlspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiissrdidflkeeeh dcfleeimtkredlvvapagitlkeaneilqrskkgklpivneddelvaiiartdlkknr
>d1b3ob4 d.37.1.1 (B:112-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II [TaxId: 9606]} qgfitdpvvlspkdrvrdcgipitdtgrmgsrlvgiisimtkredlvvapagitlkeane ilqrskkgklpivneddelvaiiartdlkknr
Timeline for d1b3ob4: