Lineage for d2z0eb1 (2z0e B:5-117)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717375Family d.15.1.3: GABARAP-like [54253] (3 proteins)
    intracellular membrane trafficking and fusion proteins
  6. 717388Protein Microtubule-associated proteins 1A/1B light chain 3B [110802] (2 species)
  7. 717391Species Rat (Rattus norvegicus) [TaxId:10116] [110803] (3 PDB entries)
  8. 717393Domain d2z0eb1: 2z0e B:5-117 [140097]
    automatically matched to d1ugma_
    mutant

Details for d2z0eb1

PDB Entry: 2z0e (more details), 1.9 Å

PDB Description: The crystal structure of human Atg4B- LC3(1-124) complex
PDB Compounds: (B:) Microtubule-associated proteins 1A/1B light chain 3B

SCOP Domain Sequences for d2z0eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z0eb1 d.15.1.3 (B:5-117) Microtubule-associated proteins 1A/1B light chain 3B {Rat (Rattus norvegicus) [TaxId: 10116]}
ktfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmseli
kiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqe

SCOP Domain Coordinates for d2z0eb1:

Click to download the PDB-style file with coordinates for d2z0eb1.
(The format of our PDB-style files is described here.)

Timeline for d2z0eb1: