SCOP 1.75: Domain d2z0db1: 2z0d B:5-117

Lineage for d2z0db1 (2z0d B:5-117)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (8 families)

5. Family d.15.1.3: GABARAP-like [54253] (3 proteins)
   intracellular membrane trafficking and fusion proteins

6. Protein Microtubule-associated proteins 1A/1B light chain 3B [110802] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [110803] (4 PDB entries)
   Uniprot Q62625 4-116

8. Domain d2z0db1: 2z0d B:5-117 [140096]
   Other proteins in same PDB: d2z0da1
   automatically matched to d1ugma_
   mutant

Details for d2z0db1

PDB Entry: 2z0d, 1.9 Å

PDB Description: the crystal structure of human atg4b- lc3(1-120) complex

PDB Compounds: (B:) Microtubule-associated proteins 1A/1B light chain 3B

SCOP Domain Sequences for d2z0db1:

Sequence; same for both SEQRES and ATOM records:

>d2z0db1 d.15.1.3 (B:5-117) Microtubule-associated proteins 1A/1B light chain 3B {Rat (Rattus norvegicus) [TaxId: 10116]}
ktfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmseli
kiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqe

Timeline for d2z0db1:

• d2z0db1 first appeared in SCOP 1.73
  
• d2z0db1 is called d2z0db_ in SCOPe 2.01
  
• d2z0db1 appears in the current release, SCOPe 2.08, called d2z0db_