Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (8 families) |
Family d.15.1.4: First domain of FERM [54256] (6 proteins) |
Protein Radixin [54259] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [54260] (10 PDB entries) |
Domain d2yvcb3: 2yvc B:3-87 [140083] Other proteins in same PDB: d2yvca1, d2yvca2, d2yvcb1, d2yvcb2, d2yvcc1, d2yvcc2 automatically matched to d1gc6a3 |
PDB Entry: 2yvc (more details), 3.2 Å
SCOP Domain Sequences for d2yvcb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvcb3 d.15.1.4 (B:3-87) Radixin {Mouse (Mus musculus) [TaxId: 10090]} kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln kkvtqqdvkkenplqfkfrakffpe
Timeline for d2yvcb3: