Lineage for d2yvcb3 (2yvc B:3-87)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 853597Superfamily d.15.1: Ubiquitin-like [54236] (8 families) (S)
  5. 853959Family d.15.1.4: First domain of FERM [54256] (6 proteins)
  6. 853988Protein Radixin [54259] (1 species)
  7. 853989Species Mouse (Mus musculus) [TaxId:10090] [54260] (10 PDB entries)
  8. 854008Domain d2yvcb3: 2yvc B:3-87 [140083]
    Other proteins in same PDB: d2yvca1, d2yvca2, d2yvcb1, d2yvcb2, d2yvcc1, d2yvcc2
    automatically matched to d1gc6a3

Details for d2yvcb3

PDB Entry: 2yvc (more details), 3.2 Å

PDB Description: Crystal structure of the Radixin FERM domain complexed with the NEP cytoplasmic tail
PDB Compounds: (B:) Radixin

SCOP Domain Sequences for d2yvcb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yvcb3 d.15.1.4 (B:3-87) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln
kkvtqqdvkkenplqfkfrakffpe

SCOP Domain Coordinates for d2yvcb3:

Click to download the PDB-style file with coordinates for d2yvcb3.
(The format of our PDB-style files is described here.)

Timeline for d2yvcb3: