Lineage for d2yvca1 (2yvc A:88-198)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986709Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1986752Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 1986753Family a.11.2.1: Second domain of FERM [47032] (9 proteins)
  6. 1986783Protein Radixin [47035] (1 species)
  7. 1986784Species Mouse (Mus musculus) [TaxId:10090] [47036] (9 PDB entries)
  8. 1986800Domain d2yvca1: 2yvc A:88-198 [140078]
    Other proteins in same PDB: d2yvca2, d2yvca3, d2yvcb2, d2yvcb3, d2yvcb4, d2yvcc2, d2yvcc3
    automatically matched to d1gc6a1

Details for d2yvca1

PDB Entry: 2yvc (more details), 3.2 Å

PDB Description: Crystal structure of the Radixin FERM domain complexed with the NEP cytoplasmic tail
PDB Compounds: (A:) Radixin

SCOPe Domain Sequences for d2yvca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yvca1 a.11.2.1 (A:88-198) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl
andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl

SCOPe Domain Coordinates for d2yvca1:

Click to download the PDB-style file with coordinates for d2yvca1.
(The format of our PDB-style files is described here.)

Timeline for d2yvca1: