Lineage for d2yu9k1 (2yu9 K:1-114)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865191Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 865274Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 865355Family d.74.3.2: RBP11/RpoL [64311] (2 proteins)
  6. 865362Protein RPB11 [64312] (1 species)
  7. 865363Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (24 PDB entries)
    Uniprot P38902; part of multichain biological unit
  8. 865386Domain d2yu9k1: 2yu9 K:1-114 [140075]
    Other proteins in same PDB: d2yu9a1, d2yu9b1, d2yu9c1, d2yu9c2, d2yu9e1, d2yu9e2, d2yu9f1, d2yu9h1, d2yu9i1, d2yu9i2, d2yu9j1, d2yu9l1
    automatically matched to d1i3qk_
    complexed with mg, utp, zn

Details for d2yu9k1

PDB Entry: 2yu9 (more details), 3.4 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with utp
PDB Compounds: (K:) DNA-directed RNA polymerase II 13.6 kDa polypeptide

SCOP Domain Sequences for d2yu9k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yu9k1 d.74.3.2 (K:1-114) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOP Domain Coordinates for d2yu9k1:

Click to download the PDB-style file with coordinates for d2yu9k1.
(The format of our PDB-style files is described here.)

Timeline for d2yu9k1: