SCOPe 2.06: Domain d2v1ka_: 2v1k A:

Lineage for d2v1ka_ (2v1k A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (10 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (84 PDB entries)

8. Domain d2v1ka_: 2v1k A: [140060]
   automated match to d1azi__
   complexed with gol, hem, so4

Details for d2v1ka_

PDB Entry: 2v1k, 1.25 Å

PDB Description: crystal structure of ferrous deoxymyoglobin at ph 6.8

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2v1ka_:

Sequence; same for both SEQRES and ATOM records:

>d2v1ka_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Timeline for d2v1ka_:

• d2v1ka_ first appeared in SCOP 1.73, called d2v1ka1
  
• d2v1ka_ appears in SCOPe 2.05
  
• d2v1ka_ appears in SCOPe 2.07
  
• d2v1ka_ appears in the current release, SCOPe 2.08