SCOP 1.75: Domain d2v1ja1: 2v1j A:1-152

Lineage for d2v1ja1 (2v1j A:1-152)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (45 PDB entries)

8. Domain d2v1ja1: 2v1j A:1-152 [140059]
   automatically matched to d1azi__
   complexed with gol, hem, so4

Details for d2v1ja1

PDB Entry: 2v1j, 1.4 Å

PDB Description: crystal structure of radiation-induced metmyoglobin - aqua ferrous myoglobin at ph 8.7

PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d2v1ja1:

Sequence; same for both SEQRES and ATOM records:

>d2v1ja1 a.1.1.2 (A:1-152) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

Timeline for d2v1ja1:

• d2v1ja1 first appeared in SCOP 1.73
  
• d2v1ja1 is called d2v1ja_ in SCOPe 2.01
  
• d2v1ja1 appears in the current release, SCOPe 2.08, called d2v1ja_