SCOP 1.75: Domain d2uxnb1: 2uxn B:376-440

Lineage for d2uxnb1 (2uxn B:376-440)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (19 families)
   consists only of helices

5. Family a.4.1.3: Myb/SANT domain [46739] (15 proteins)

6. Protein REST corepressor 1, CoREST [140165] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140166] (2 PDB entries)
   Uniprot Q9UKL0 376-440

8. Domain d2uxnb1: 2uxn B:376-440 [140024]
   Other proteins in same PDB: d2uxna1, d2uxna2, d2uxna3
   automatically matched to 2IW5 B:376-440
   complexed with cl, fda, gol, lyp

Details for d2uxnb1

PDB Entry: 2uxn, 2.72 Å

PDB Description: structural basis of histone demethylation by lsd1 revealed by suicide inactivation

PDB Compounds: (B:) rest corepressor 1

SCOP Domain Sequences for d2uxnb1:

Sequence; same for both SEQRES and ATOM records:

>d2uxnb1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]}
iqkcnarwtteeqllavqairkygrdfqaisdvignksvvqvknffvnyrrrfnidevlq
eweae

Timeline for d2uxnb1:

• d2uxnb1 first appeared in SCOP 1.73
  
• d2uxnb1 appears in SCOPe 2.01
  
• d2uxnb1 appears in the current release, SCOPe 2.08