Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (19 families) consists only of helices |
Family a.4.1.3: Myb/SANT domain [46739] (15 proteins) |
Protein REST corepressor 1, CoREST [140165] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140166] (2 PDB entries) Uniprot Q9UKL0 376-440 |
Domain d2uxnb1: 2uxn B:376-440 [140024] Other proteins in same PDB: d2uxna1, d2uxna2, d2uxna3 automatically matched to 2IW5 B:376-440 complexed with cl, fda, gol, lyp |
PDB Entry: 2uxn (more details), 2.72 Å
SCOP Domain Sequences for d2uxnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxnb1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} iqkcnarwtteeqllavqairkygrdfqaisdvignksvvqvknffvnyrrrfnidevlq eweae
Timeline for d2uxnb1: