Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.1: Translational machinery components [54212] (5 proteins) |
Protein Ribosomal protein S9 [54218] (2 species) |
Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries) Uniprot P80374 |
Domain d2uxci1: 2uxc I:2-128 [140012] Other proteins in same PDB: d2uxcb1, d2uxcc1, d2uxcc2, d2uxcd1, d2uxce1, d2uxce2, d2uxcf1, d2uxcg1, d2uxch1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcp1, d2uxcq1, d2uxcr1, d2uxcs1, d2uxct1, d2uxcu1 automatically matched to d1fjgi_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uxc (more details), 2.9 Å
SCOPe Domain Sequences for d2uxci1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxci1 d.14.1.1 (I:2-128) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]} eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr apqyskr
Timeline for d2uxci1: