![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
![]() | Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) ![]() |
![]() | Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
![]() | Protein Ribosomal protein S8 [56049] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries) Uniprot P24319 |
![]() | Domain d2uxch1: 2uxc H:1-138 [140011] Other proteins in same PDB: d2uxcb1, d2uxcc1, d2uxcc2, d2uxcd1, d2uxce1, d2uxce2, d2uxcf1, d2uxcg1, d2uxci1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcp1, d2uxcq1, d2uxcr1, d2uxcs1, d2uxct1, d2uxcu1 automatically matched to d1fjgh_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uxc (more details), 2.9 Å
SCOPe Domain Sequences for d2uxch1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxch1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]} mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt drearklgvggelicevw
Timeline for d2uxch1: