Lineage for d2uxcg1 (2uxc G:2-156)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331851Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 2331852Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 2331853Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 2331854Protein Ribosomal protein S7 [47975] (4 species)
  7. 2331884Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 2331900Domain d2uxcg1: 2uxc G:2-156 [140010]
    Other proteins in same PDB: d2uxcb1, d2uxcc1, d2uxcc2, d2uxcd1, d2uxce1, d2uxce2, d2uxcf1, d2uxch1, d2uxci1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcp1, d2uxcq1, d2uxcr1, d2uxcs1, d2uxct1, d2uxcu1
    automatically matched to d1fjgg_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxcg1

PDB Entry: 2uxc (more details), 2.9 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (G:) ribosomal protein s7

SCOPe Domain Sequences for d2uxcg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxcg1 a.75.1.1 (G:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d2uxcg1:

Click to download the PDB-style file with coordinates for d2uxcg1.
(The format of our PDB-style files is described here.)

Timeline for d2uxcg1: