Lineage for d2uxcf1 (2uxc F:1-101)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1206291Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1206292Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1206293Protein Ribosomal protein S6 [54997] (4 species)
  7. 1206323Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 1206336Domain d2uxcf1: 2uxc F:1-101 [140009]
    Other proteins in same PDB: d2uxcb1, d2uxcc1, d2uxcc2, d2uxcd1, d2uxce1, d2uxce2, d2uxcg1, d2uxch1, d2uxci1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcp1, d2uxcq1, d2uxcr1, d2uxcs1, d2uxct1, d2uxcu1
    automatically matched to d1fjgf_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxcf1

PDB Entry: 2uxc (more details), 2.9 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (F:) ribosomal protein s6

SCOPe Domain Sequences for d2uxcf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxcf1 d.58.14.1 (F:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d2uxcf1:

Click to download the PDB-style file with coordinates for d2uxcf1.
(The format of our PDB-style files is described here.)

Timeline for d2uxcf1: