Lineage for d2uxce1 (2uxc E:74-154)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930061Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. 2930109Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)
  7. 2930137Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
    Uniprot P27152 ! Uniprot P80373
  8. 2930148Domain d2uxce1: 2uxc E:74-154 [140007]
    Other proteins in same PDB: d2uxcb1, d2uxcc1, d2uxcc2, d2uxcd1, d2uxce2, d2uxcf1, d2uxcg1, d2uxch1, d2uxci1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcp1, d2uxcq1, d2uxcr1, d2uxcs1, d2uxct1, d2uxcu1
    automatically matched to d1i94e1
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxce1

PDB Entry: 2uxc (more details), 2.9 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (E:) ribosomal protein s5

SCOPe Domain Sequences for d2uxce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxce1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

SCOPe Domain Coordinates for d2uxce1:

Click to download the PDB-style file with coordinates for d2uxce1.
(The format of our PDB-style files is described here.)

Timeline for d2uxce1: