Lineage for d2uwmb3 (2uwm B:575-633)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479476Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (2 proteins)
  6. Protein C-terminal fragment of elongation factor SelB [74684] (1 species)
    duplication: tandem repeat of four "winged helix" domains
  7. Species Moorella thermoacetica [TaxId:1525] [74685] (4 PDB entries)
  8. 1479488Domain d2uwmb3: 2uwm B:575-633 [139997]
    automatically matched to d1lvaa4
    protein/RNA complex

Details for d2uwmb3

PDB Entry: 2uwm (more details), 2.31 Å

PDB Description: c-terminal domain(wh2-wh4) of elongation factor selb in complex with secis rna
PDB Compounds: (B:) Selenocysteine-specific elongation factor

SCOPe Domain Sequences for d2uwmb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uwmb3 a.4.5.35 (B:575-633) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]}
qalgeareviknlastgpfglaeardalgssrkyvlplleyldqvkftrrvgdkrvvvg

SCOPe Domain Coordinates for d2uwmb3:

Click to download the PDB-style file with coordinates for d2uwmb3.
(The format of our PDB-style files is described here.)

Timeline for d2uwmb3: