Lineage for d2uw9a1 (2uw9 A:146-479)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735361Protein Pkb kinase (Akt-2) [82791] (1 species)
    AGC group; RAC/Akt subfamily; serine/threonine kinase
  7. 735362Species Human (Homo sapiens) [TaxId:9606] [82792] (10 PDB entries)
  8. 735367Domain d2uw9a1: 2uw9 A:146-479 [139988]
    automatically matched to d1o6la_
    complexed with gvp

Details for d2uw9a1

PDB Entry: 2uw9 (more details), 2.1 Å

PDB Description: structure of pkb-beta (akt2) complexed with 4-(4-chloro-phenyl)-4-(4-(1h-pyrazol-4-yl)-phenyl)-piperidine
PDB Compounds: (A:) rac-beta serine/threonine-protein kinase

SCOP Domain Sequences for d2uw9a1:

Sequence, based on SEQRES records: (download)

>d2uw9a1 d.144.1.7 (A:146-479) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]}
kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
qsititppdrydslglleldqreeqemfedfdyiadw

Sequence, based on observed residues (ATOM records): (download)

>d2uw9a1 d.144.1.7 (A:146-479) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]}
kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
qsitqemfedfdyiadw

SCOP Domain Coordinates for d2uw9a1:

Click to download the PDB-style file with coordinates for d2uw9a1.
(The format of our PDB-style files is described here.)

Timeline for d2uw9a1: