Lineage for d2uucr1 (2uuc R:19-88)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 636073Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 636074Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 636075Protein Ribosomal protein S18 [46913] (1 species)
  7. 636076Species Thermus thermophilus [TaxId:274] [46914] (38 PDB entries)
  8. 636078Domain d2uucr1: 2uuc R:19-88 [139969]
    Other proteins in same PDB: d2uucb1, d2uucc1, d2uucc2, d2uucd1, d2uuce1, d2uuce2, d2uucf1, d2uucg1, d2uuch1, d2uucj1, d2uuck1, d2uucl1, d2uucm1, d2uucn1, d2uuco1, d2uucp1, d2uucq1, d2uucs1, d2uuct1
    automatically matched to 2J00 R:19-88
    complexed with 6mz, cm0, k, mg, par, zn

Details for d2uucr1

PDB Entry: 2uuc (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
PDB Compounds: (R:) 30S ribosomal protein S18

SCOP Domain Sequences for d2uucr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uucr1 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
kakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsakeqrilaktikrarilgl
lpfteklvrk

SCOP Domain Coordinates for d2uucr1:

Click to download the PDB-style file with coordinates for d2uucr1.
(The format of our PDB-style files is described here.)

Timeline for d2uucr1: