![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) ![]() |
![]() | Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit |
![]() | Protein Ribosomal protein S15 [47065] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries) |
![]() | Domain d2uuco1: 2uuc O:2-89 [139966] Other proteins in same PDB: d2uucb1, d2uucc1, d2uucc2, d2uucd1, d2uuce1, d2uuce2, d2uucf1, d2uucg1, d2uuch1, d2uucj1, d2uuck1, d2uucl1, d2uucm1, d2uucn1, d2uucp1, d2uucq1, d2uucr1, d2uucs1, d2uuct1 automatically matched to d1ab3__ complexed with 6mz, cm0, k, mg, par, zn |
PDB Entry: 2uuc (more details), 3.1 Å
SCOP Domain Sequences for d2uuco1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uuco1 a.16.1.2 (O:2-89) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyralieklgirg
Timeline for d2uuco1: