| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) ![]() |
| Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein) |
| Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species) lacks the N-terminal helix |
| Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries) |
| Domain d2uuce2: 2uuc E:5-73 [139957] Other proteins in same PDB: d2uucb1, d2uucc1, d2uucc2, d2uucd1, d2uuce1, d2uucf1, d2uucg1, d2uuch1, d2uucj1, d2uuck1, d2uucl1, d2uucm1, d2uucn1, d2uuco1, d2uucp1, d2uucq1, d2uucr1, d2uucs1, d2uuct1 automatically matched to d1i94e2 complexed with 6mz, cm0, k, mg, par, zn |
PDB Entry: 2uuc (more details), 3.1 Å
SCOP Domain Sequences for d2uuce2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uuce2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn
Timeline for d2uuce2: