SCOPe 2.01: Domain d2uuce1: 2uuc E:74-154

Lineage for d2uuce1 (2uuc E:74-154)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
   Uniprot P27152 ! Uniprot P80373

8. Domain d2uuce1: 2uuc E:74-154 [139956]
   Other proteins in same PDB: d2uucb1, d2uucc1, d2uucc2, d2uucd1, d2uuce2, d2uucf1, d2uucg1, d2uuch1, d2uucj1, d2uuck1, d2uucl1, d2uucm1, d2uucn1, d2uuco1, d2uucp1, d2uucq1, d2uucr1, d2uucs1, d2uuct1, d2uucu1
   automatically matched to d1i94e1
   protein/RNA complex; complexed with k, mg, par, zn

Details for d2uuce1

PDB Entry: 2uuc, 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.

PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2uuce1:

Sequence; same for both SEQRES and ATOM records:

>d2uuce1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

Timeline for d2uuce1:

• d2uuce1 first appeared in SCOP 1.73
  
• d2uuce1 appears in SCOP 1.75
  
• d2uuce1 appears in SCOPe 2.02
  
• d2uuce1 appears in the current release, SCOPe 2.08