SCOPe 2.07: Domain d2uucc2: 2uuc C:107-207

Lineage for d2uucc2 (2uuc C:107-207)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)
   automatically mapped to Pfam PF00189

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
   Uniprot P80372

8. Domain d2uucc2: 2uuc C:107-207 [139954]
   Other proteins in same PDB: d2uucb1, d2uucc1, d2uucd1, d2uuce1, d2uuce2, d2uucf1, d2uucg1, d2uuch1, d2uucj1, d2uuck1, d2uucl1, d2uucm1, d2uucn1, d2uuco1, d2uucp1, d2uucq1, d2uucr1, d2uucs1, d2uuct1, d2uucu1
   automatically matched to d1fjgc2
   protein/RNA complex; complexed with k, mg, par, zn

Details for d2uucc2

PDB Entry: 2uuc, 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2uucc2:

Sequence; same for both SEQRES and ATOM records:

>d2uucc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

Timeline for d2uucc2:

• d2uucc2 first appeared in SCOP 1.73
  
• d2uucc2 appears in SCOPe 2.06
  
• d2uucc2 appears in the current release, SCOPe 2.08