SCOPe 2.04: Domain d2uucc1: 2uuc C:2-106

Lineage for d2uucc1 (2uuc C:2-106)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)

7. Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries)
   Uniprot P80372

8. Domain d2uucc1: 2uuc C:2-106 [139953]
   Other proteins in same PDB: d2uucb1, d2uucc2, d2uucd1, d2uuce1, d2uuce2, d2uucf1, d2uucg1, d2uuch1, d2uucj1, d2uuck1, d2uucl1, d2uucm1, d2uucn1, d2uuco1, d2uucp1, d2uucq1, d2uucr1, d2uucs1, d2uuct1, d2uucu1
   automatically matched to d1fjgc1
   protein/RNA complex; complexed with k, mg, par, zn

Details for d2uucc1

PDB Entry: 2uuc, 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2uucc1:

Sequence; same for both SEQRES and ATOM records:

>d2uucc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

Timeline for d2uucc1:

• d2uucc1 first appeared in SCOP 1.73
  
• d2uucc1 appears in SCOPe 2.03
  
• d2uucc1 appears in SCOPe 2.05
  
• d2uucc1 appears in the current release, SCOPe 2.08