SCOPe 2.05: Domain d2uubm1: 2uub M:2-126

Lineage for d2uubm1 (2uub M:2-126)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (4 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
   contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
   automatically mapped to Pfam PF00416

6. Protein Ribosomal protein S13 [46948] (2 species)

7. Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries)
   Uniprot P80377

8. Domain d2uubm1: 2uub M:2-126 [139944]
   Other proteins in same PDB: d2uubb1, d2uubc1, d2uubc2, d2uubd1, d2uube1, d2uube2, d2uubf1, d2uubg1, d2uubh1, d2uubj1, d2uubk1, d2uubl1, d2uubn1, d2uubo1, d2uubp1, d2uubq1, d2uubr1, d2uubs1, d2uubt1, d2uubu1
   automatically matched to d1fjgm_
   protein/RNA complex; complexed with k, mg, par, zn

Details for d2uubm1

PDB Entry: 2uub, 2.9 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.

PDB Compounds: (M:) 30S ribosomal protein S13

SCOPe Domain Sequences for d2uubm1:

Sequence; same for both SEQRES and ATOM records:

>d2uubm1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

Timeline for d2uubm1:

• d2uubm1 first appeared in SCOP 1.73
  
• d2uubm1 appears in SCOPe 2.04
  
• d2uubm1 appears in SCOPe 2.06
  
• d2uubm1 appears in the current release, SCOPe 2.08