Lineage for d2uubf1 (2uub F:1-101)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1028924Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1028925Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1028926Protein Ribosomal protein S6 [54997] (4 species)
  7. 1028956Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 1028962Domain d2uubf1: 2uub F:1-101 [139938]
    Other proteins in same PDB: d2uubb1, d2uubc1, d2uubc2, d2uubd1, d2uube1, d2uube2, d2uubg1, d2uubh1, d2uubj1, d2uubk1, d2uubl1, d2uubm1, d2uubn1, d2uubo1, d2uubp1, d2uubq1, d2uubr1, d2uubs1, d2uubt1, d2uubu1
    automatically matched to d1fjgf_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uubf1

PDB Entry: 2uub (more details), 2.9 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2uubf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uubf1 d.58.14.1 (F:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d2uubf1:

Click to download the PDB-style file with coordinates for d2uubf1.
(The format of our PDB-style files is described here.)

Timeline for d2uubf1: