Lineage for d2uubb1 (2uub B:7-240)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1589041Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 1589042Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 1589043Protein Ribosomal protein S2 [52315] (3 species)
  7. 1589080Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries)
    Uniprot P80371
  8. 1589081Domain d2uubb1: 2uub B:7-240 [139932]
    Other proteins in same PDB: d2uubc1, d2uubc2, d2uubd1, d2uube1, d2uube2, d2uubf1, d2uubg1, d2uubh1, d2uubj1, d2uubk1, d2uubl1, d2uubm1, d2uubn1, d2uubo1, d2uubp1, d2uubq1, d2uubr1, d2uubs1, d2uubt1, d2uubu1
    automatically matched to d1i94b_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uubb1

PDB Entry: 2uub (more details), 2.9 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
PDB Compounds: (B:) 30S ribosomal protein S2

SCOPe Domain Sequences for d2uubb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uubb1 c.23.15.1 (B:7-240) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

SCOPe Domain Coordinates for d2uubb1:

Click to download the PDB-style file with coordinates for d2uubb1.
(The format of our PDB-style files is described here.)

Timeline for d2uubb1: