Lineage for d2uuat1 (2uua T:8-106)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985818Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1985989Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
    automatically mapped to Pfam PF01649
  5. 1985990Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 1985991Protein Ribosomal protein S20 [46994] (2 species)
  7. 1986019Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries)
    Uniprot P80380
  8. 1986023Domain d2uuat1: 2uua T:8-106 [139931]
    Other proteins in same PDB: d2uuab1, d2uuac1, d2uuac2, d2uuad1, d2uuae1, d2uuae2, d2uuaf1, d2uuag1, d2uuah1, d2uuaj1, d2uuak1, d2uual1, d2uuam1, d2uuan1, d2uuao1, d2uuap1, d2uuaq1, d2uuar1, d2uuas1, d2uuau1
    automatically matched to d1i94t_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uuat1

PDB Entry: 2uua (more details), 2.9 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
PDB Compounds: (T:) 30S ribosomal protein S20

SCOPe Domain Sequences for d2uuat1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uuat1 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOPe Domain Coordinates for d2uuat1:

Click to download the PDB-style file with coordinates for d2uuat1.
(The format of our PDB-style files is described here.)

Timeline for d2uuat1: