Lineage for d2uuar1 (2uua R:19-88)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1723549Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1723550Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1723551Protein Ribosomal protein S18 [46913] (2 species)
  7. 1723577Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 1723581Domain d2uuar1: 2uua R:19-88 [139929]
    Other proteins in same PDB: d2uuab1, d2uuac1, d2uuac2, d2uuad1, d2uuae1, d2uuae2, d2uuaf1, d2uuag1, d2uuah1, d2uuaj1, d2uuak1, d2uual1, d2uuam1, d2uuan1, d2uuao1, d2uuap1, d2uuaq1, d2uuas1, d2uuat1, d2uuau1
    automatically matched to 2J00 R:19-88
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uuar1

PDB Entry: 2uua (more details), 2.9 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2uuar1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uuar1 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
kakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsakeqrilaktikrarilgl
lpfteklvrk

SCOPe Domain Coordinates for d2uuar1:

Click to download the PDB-style file with coordinates for d2uuar1.
(The format of our PDB-style files is described here.)

Timeline for d2uuar1: