![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
![]() | Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) ![]() |
![]() | Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
![]() | Protein Ribosomal protein S16 [54567] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries) Uniprot P80379 |
![]() | Domain d2uuap1: 2uua P:1-83 [139927] Other proteins in same PDB: d2uuab1, d2uuac1, d2uuac2, d2uuad1, d2uuae1, d2uuae2, d2uuaf1, d2uuag1, d2uuah1, d2uuaj1, d2uuak1, d2uual1, d2uuam1, d2uuan1, d2uuao1, d2uuaq1, d2uuar1, d2uuas1, d2uuat1, d2uuau1 automatically matched to d1emwa_ complexed with 6mz, cm0, k, mg, par, zn |
PDB Entry: 2uua (more details), 2.9 Å
SCOP Domain Sequences for d2uuap1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uuap1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqe
Timeline for d2uuap1: