Class a: All alpha proteins [46456] (290 folds) |
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) |
Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit automatically mapped to Pfam PF00312 |
Protein Ribosomal protein S15 [47065] (3 species) |
Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries) Uniprot P80378 |
Domain d2uuao1: 2uua O:2-89 [139926] Other proteins in same PDB: d2uuab1, d2uuac1, d2uuac2, d2uuad1, d2uuae1, d2uuae2, d2uuaf1, d2uuag1, d2uuah1, d2uuaj1, d2uuak1, d2uual1, d2uuam1, d2uuan1, d2uuap1, d2uuaq1, d2uuar1, d2uuas1, d2uuat1, d2uuau1 automatically matched to d1ab3__ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uua (more details), 2.9 Å
SCOPe Domain Sequences for d2uuao1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uuao1 a.16.1.2 (O:2-89) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyralieklgirg
Timeline for d2uuao1: