Lineage for d2uuam1 (2uua M:2-126)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650278Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 650279Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 650280Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
  6. 650281Protein Ribosomal protein S13 [46948] (1 species)
  7. 650282Species Thermus thermophilus [TaxId:274] [46949] (36 PDB entries)
  8. 650298Domain d2uuam1: 2uua M:2-126 [139924]
    Other proteins in same PDB: d2uuab1, d2uuac1, d2uuac2, d2uuad1, d2uuae1, d2uuae2, d2uuaf1, d2uuag1, d2uuah1, d2uuaj1, d2uuak1, d2uual1, d2uuan1, d2uuao1, d2uuap1, d2uuaq1, d2uuar1, d2uuas1, d2uuat1
    automatically matched to d1fjgm_
    complexed with 6mz, cm0, k, mg, par, zn

Details for d2uuam1

PDB Entry: 2uua (more details), 2.9 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
PDB Compounds: (M:) 30S ribosomal protein S13

SCOP Domain Sequences for d2uuam1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uuam1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOP Domain Coordinates for d2uuam1:

Click to download the PDB-style file with coordinates for d2uuam1.
(The format of our PDB-style files is described here.)

Timeline for d2uuam1: