Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) automatically mapped to Pfam PF00410 |
Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
Protein Ribosomal protein S8 [56049] (4 species) |
Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries) Uniprot P24319 |
Domain d2uuah1: 2uua H:1-138 [139920] Other proteins in same PDB: d2uuab1, d2uuac1, d2uuac2, d2uuad1, d2uuae1, d2uuae2, d2uuaf1, d2uuag1, d2uuaj1, d2uuak1, d2uual1, d2uuam1, d2uuan1, d2uuao1, d2uuap1, d2uuaq1, d2uuar1, d2uuas1, d2uuat1, d2uuau1 automatically matched to d1fjgh_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uua (more details), 2.9 Å
SCOPe Domain Sequences for d2uuah1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uuah1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]} mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt drearklgvggelicevw
Timeline for d2uuah1: