Lineage for d2uuae1 (2uua E:74-154)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176343Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2176344Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2176345Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 2176390Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)
  7. 2176418Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
    Uniprot P27152 ! Uniprot P80373
  8. 2176420Domain d2uuae1: 2uua E:74-154 [139916]
    Other proteins in same PDB: d2uuab1, d2uuac1, d2uuac2, d2uuad1, d2uuae2, d2uuaf1, d2uuag1, d2uuah1, d2uuaj1, d2uuak1, d2uual1, d2uuam1, d2uuan1, d2uuao1, d2uuap1, d2uuaq1, d2uuar1, d2uuas1, d2uuat1, d2uuau1
    automatically matched to d1i94e1
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uuae1

PDB Entry: 2uua (more details), 2.9 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2uuae1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uuae1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

SCOPe Domain Coordinates for d2uuae1:

Click to download the PDB-style file with coordinates for d2uuae1.
(The format of our PDB-style files is described here.)

Timeline for d2uuae1: