Lineage for d2uu9s1 (2uu9 S:2-81)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900608Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 1900609Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
    automatically mapped to Pfam PF00203
  5. 1900610Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 1900611Protein Ribosomal protein S19 [54572] (2 species)
  7. 1900639Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
    Uniprot P80381
  8. 1900647Domain d2uu9s1: 2uu9 S:2-81 [139910]
    Other proteins in same PDB: d2uu9b1, d2uu9c1, d2uu9c2, d2uu9d1, d2uu9e1, d2uu9e2, d2uu9f1, d2uu9g1, d2uu9h1, d2uu9j1, d2uu9k1, d2uu9l1, d2uu9m1, d2uu9n1, d2uu9o1, d2uu9p1, d2uu9q1, d2uu9r1, d2uu9t1, d2uu9u1
    automatically matched to d1fjgs_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uu9s1

PDB Entry: 2uu9 (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d2uu9s1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uu9s1 d.28.1.1 (S:2-81) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOPe Domain Coordinates for d2uu9s1:

Click to download the PDB-style file with coordinates for d2uu9s1.
(The format of our PDB-style files is described here.)

Timeline for d2uu9s1: