Lineage for d2uu9q1 (2uu9 Q:2-101)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399628Protein Ribosomal protein S17 [50304] (3 species)
  7. 2399658Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries)
    Uniprot P24321
  8. 2399681Domain d2uu9q1: 2uu9 Q:2-101 [139908]
    Other proteins in same PDB: d2uu9b1, d2uu9c1, d2uu9c2, d2uu9d1, d2uu9e1, d2uu9e2, d2uu9f1, d2uu9g1, d2uu9h1, d2uu9j1, d2uu9k1, d2uu9l1, d2uu9m1, d2uu9n1, d2uu9o1, d2uu9p1, d2uu9r1, d2uu9s1, d2uu9t1, d2uu9u1
    automatically matched to 2J00 Q:2-101
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uu9q1

PDB Entry: 2uu9 (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d2uu9q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uu9q1 b.40.4.5 (Q:2-101) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyeslskr

SCOPe Domain Coordinates for d2uu9q1:

Click to download the PDB-style file with coordinates for d2uu9q1.
(The format of our PDB-style files is described here.)

Timeline for d2uu9q1: