Lineage for d2uu9k1 (2uu9 K:11-129)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2140543Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 2140544Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 2140634Protein Ribosomal protein S11 [53141] (2 species)
  7. 2140660Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries)
    Uniprot P80376
  8. 2140669Domain d2uu9k1: 2uu9 K:11-129 [139902]
    Other proteins in same PDB: d2uu9b1, d2uu9c1, d2uu9c2, d2uu9d1, d2uu9e1, d2uu9e2, d2uu9f1, d2uu9g1, d2uu9h1, d2uu9j1, d2uu9l1, d2uu9m1, d2uu9n1, d2uu9o1, d2uu9p1, d2uu9q1, d2uu9r1, d2uu9s1, d2uu9t1, d2uu9u1
    automatically matched to d1i94k_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uu9k1

PDB Entry: 2uu9 (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d2uu9k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uu9k1 c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

SCOPe Domain Coordinates for d2uu9k1:

Click to download the PDB-style file with coordinates for d2uu9k1.
(The format of our PDB-style files is described here.)

Timeline for d2uu9k1: