Lineage for d2uu9j1 (2uu9 J:3-100)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560593Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
    automatically mapped to Pfam PF00338
  5. 2560594Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 2560595Protein Ribosomal protein S10 [55001] (2 species)
  7. 2560621Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
    Uniprot P80375
  8. 2560644Domain d2uu9j1: 2uu9 J:3-100 [139901]
    Other proteins in same PDB: d2uu9b1, d2uu9c1, d2uu9c2, d2uu9d1, d2uu9e1, d2uu9e2, d2uu9f1, d2uu9g1, d2uu9h1, d2uu9k1, d2uu9l1, d2uu9m1, d2uu9n1, d2uu9o1, d2uu9p1, d2uu9q1, d2uu9r1, d2uu9s1, d2uu9t1, d2uu9u1
    automatically matched to d1fjgj_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uu9j1

PDB Entry: 2uu9 (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d2uu9j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uu9j1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOPe Domain Coordinates for d2uu9j1:

Click to download the PDB-style file with coordinates for d2uu9j1.
(The format of our PDB-style files is described here.)

Timeline for d2uu9j1: