Lineage for d2uu9f1 (2uu9 F:1-101)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560503Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 2560504Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 2560505Protein Ribosomal protein S6 [54997] (4 species)
  7. 2560535Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 2560563Domain d2uu9f1: 2uu9 F:1-101 [139898]
    Other proteins in same PDB: d2uu9b1, d2uu9c1, d2uu9c2, d2uu9d1, d2uu9e1, d2uu9e2, d2uu9g1, d2uu9h1, d2uu9j1, d2uu9k1, d2uu9l1, d2uu9m1, d2uu9n1, d2uu9o1, d2uu9p1, d2uu9q1, d2uu9r1, d2uu9s1, d2uu9t1, d2uu9u1
    automatically matched to d1fjgf_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uu9f1

PDB Entry: 2uu9 (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2uu9f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uu9f1 d.58.14.1 (F:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d2uu9f1:

Click to download the PDB-style file with coordinates for d2uu9f1.
(The format of our PDB-style files is described here.)

Timeline for d2uu9f1: