Lineage for d2uu9e1 (2uu9 E:74-154)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194044Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1194045Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1194046Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1194087Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)
  7. 1194115Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
    Uniprot P27152 ! Uniprot P80373
  8. 1194123Domain d2uu9e1: 2uu9 E:74-154 [139896]
    Other proteins in same PDB: d2uu9b1, d2uu9c1, d2uu9c2, d2uu9d1, d2uu9e2, d2uu9f1, d2uu9g1, d2uu9h1, d2uu9j1, d2uu9k1, d2uu9l1, d2uu9m1, d2uu9n1, d2uu9o1, d2uu9p1, d2uu9q1, d2uu9r1, d2uu9s1, d2uu9t1, d2uu9u1
    automatically matched to d1i94e1
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uu9e1

PDB Entry: 2uu9 (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2uu9e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uu9e1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

SCOPe Domain Coordinates for d2uu9e1:

Click to download the PDB-style file with coordinates for d2uu9e1.
(The format of our PDB-style files is described here.)

Timeline for d2uu9e1: