Lineage for d2q8la1 (2q8l A:1-323)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 814383Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 814448Family c.1.2.3: Decarboxylase [51375] (3 proteins)
  6. 814562Protein Protozoan orotidine monophosphate decarboxylase [141749] (5 species)
  7. 814581Species Plasmodium falciparum [TaxId:5833] [141751] (2 PDB entries)
    Uniprot Q8T6J6 1-323
  8. 814582Domain d2q8la1: 2q8l A:1-323 [139891]
    automatically matched to 2F84 A:1-323
    complexed with po4

Details for d2q8la1

PDB Entry: 2q8l (more details), 2.1 Å

PDB Description: Crystal structure of orotidine 5'-phosphate decarboxylase from Plasmodium falciparum
PDB Compounds: (A:) orotidine-monophosphate-decarboxylase

SCOP Domain Sequences for d2q8la1:

Sequence, based on SEQRES records: (download)

>d2q8la1 c.1.2.3 (A:1-323) Protozoan orotidine monophosphate decarboxylase {Plasmodium falciparum [TaxId: 5833]}
mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
ypqkaaqmyydqinailkqnmes

Sequence, based on observed residues (ATOM records): (download)

>d2q8la1 c.1.2.3 (A:1-323) Protozoan orotidine monophosphate decarboxylase {Plasmodium falciparum [TaxId: 5833]}
mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
eknkyysafvlvkttnpdsaifqkqayvimaqealnmssylnleqnnefigfvvgansyd
emnyirtyfpncyilspgigngdlhktltngyhksyekilinigraitknpypqkaaqmy
ydqinailkqnmes

SCOP Domain Coordinates for d2q8la1:

Click to download the PDB-style file with coordinates for d2q8la1.
(The format of our PDB-style files is described here.)

Timeline for d2q8la1: