Lineage for d2q4xb1 (2q4x B:5-219)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777762Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 777763Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 777877Family a.132.1.3: TENA/THI-4 [101458] (8 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 777910Protein Seed maturation protein-related At3g16990 [101461] (1 species)
  7. 777911Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101462] (2 PDB entries)
    structural genomics
  8. 777915Domain d2q4xb1: 2q4x B:5-219 [139881]
    automatically matched to d1q4mb_
    complexed with hmh, so4

Details for d2q4xb1

PDB Entry: 2q4x (more details), 2.1 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At3g16990
PDB Compounds: (B:) seed maturation protein pm36 homolog

SCOP Domain Sequences for d2q4xb1:

Sequence, based on SEQRES records: (download)

>d2q4xb1 a.132.1.3 (B:5-219) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvasvlir
ackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfledlms
sevkypvimtafwaieavyqesfahcledgnktpveltgachrwgndgfkqycssvknia
erclenasgevlgeaedvlvrvlelevafwemsrg

Sequence, based on observed residues (ATOM records): (download)

>d2q4xb1 a.132.1.3 (B:5-219) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvasvlir
ackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfledlms
sevkypvimtafwaieavyqesfahcktpveltgachrwgndgfkqycssvkniaercle
nasgevlgeaedvlvrvlelevafwemsrg

SCOP Domain Coordinates for d2q4xb1:

Click to download the PDB-style file with coordinates for d2q4xb1.
(The format of our PDB-style files is described here.)

Timeline for d2q4xb1: