Lineage for d2q4sa1 (2q4s A:5-190)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 809735Superfamily b.82.1: RmlC-like cupins [51182] (24 families) (S)
  5. 810136Family b.82.1.19: Cysteine dioxygenase type I [141615] (1 protein)
    Pfam PF05995, CDO_I
  6. 810137Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 810140Species Mouse (Mus musculus) [TaxId:10090] [141617] (4 PDB entries)
    Uniprot P60334 5-190
  8. 810144Domain d2q4sa1: 2q4s A:5-190 [139877]
    automatically matched to 2ATF A:5-190
    complexed with edo, ni

Details for d2q4sa1

PDB Entry: 2q4s (more details), 1.75 Å

PDB Description: Ensemble refinement of the protein crystal structure of cysteine dioxygenase type I from Mus musculus Mm.241056
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOP Domain Sequences for d2q4sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q4sa1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Mouse (Mus musculus) [TaxId: 10090]}
ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
fgirtp

SCOP Domain Coordinates for d2q4sa1:

Click to download the PDB-style file with coordinates for d2q4sa1.
(The format of our PDB-style files is described here.)

Timeline for d2q4sa1: