Lineage for d2q47a1 (2q47 A:52-202)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875107Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 2875152Protein Putative phosphatase At1g05000 [117579] (1 species)
  7. 2875153Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117580] (2 PDB entries)
    Uniprot Q9ZVN4 52-201
  8. 2875154Domain d2q47a1: 2q47 A:52-202 [139827]
    automatically matched to d1xria_
    complexed with so4

Details for d2q47a1

PDB Entry: 2q47 (more details), 3.3 Å

PDB Description: Ensemble refinement of the protein crystal structure of a putative phosphoprotein phosphatase from Arabidopsis thaliana gene At1g05000
PDB Compounds: (A:) Probable tyrosine-protein phosphatase At1g05000

SCOPe Domain Sequences for d2q47a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q47a1 c.45.1.1 (A:52-202) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hlipplnfsmvdngifrsgfpdsanfsflqtlglrsiiylcpepypesnlqflksngirl
fqfgiegnkepfvnipdhkirmalkvlldeknhpvlihckrgkhrtgclvgclrklqkwc
ltsifdeyqrfaaakarvsdqrfmeifdvss

SCOPe Domain Coordinates for d2q47a1:

Click to download the PDB-style file with coordinates for d2q47a1.
(The format of our PDB-style files is described here.)

Timeline for d2q47a1: