SCOPe 2.08: Domain d2q43a1: 2q43 A:16-194,A:314-407

Lineage for d2q43a1 (2q43 A:16-194,A:314-407)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)

6. Protein IAA-amino acid hydrolase, catalytic domain [117663] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117664] (2 PDB entries)
   Uniprot P54970 37-428

8. Domain d2q43a1: 2q43 A:16-194,A:314-407 [139821]
   Other proteins in same PDB: d2q43a2
   automated match to d1xmba1

Details for d2q43a1

PDB Entry: 2q43, 2 Å

PDB Description: Ensemble refinement of the protein crystal structure of IAA-aminoacid hydrolase from Arabidopsis thaliana gene At5g56660

PDB Compounds: (A:) IAA-amino acid hydrolase ILR1-like 2

SCOPe Domain Sequences for d2q43a1:

Sequence; same for both SEQRES and ATOM records:

>d2q43a1 c.56.5.4 (A:16-194,A:314-407) IAA-amino acid hydrolase, catalytic domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kllefakspevfdwmvkirrkihenpelgyeeletsklirseleligikyrypvaitgvi
gyigtgeppfvalradmdalpiqegvewehkskiagkmhacghdghvtmllgaakilheh
rhhlqgtvvlifqpaeeglsgakkmreegalknveaifgihlsaripfgkaasragsflX
tvnnkdlykqfkkvvrdllgqeafveaapvmgsedfsyfaetipghfsllgmqdetngya
sshsplyrinedvlpygaaihasmavqylkekas

Timeline for d2q43a1:

• d2q43a1 first appeared in SCOP 1.73
  
• d2q43a1 appears in SCOPe 2.07