Lineage for d2q3ub_ (2q3u B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1217588Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 1217589Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 1217661Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins)
    Pfam PF04371; functionally related to the amidinotransferase, similar active site
  6. 1217683Protein automated matches [190353] (1 species)
    not a true protein
  7. 1217684Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187181] (3 PDB entries)
  8. 1217687Domain d2q3ub_: 2q3u B: [139810]
    automated match to d1vkpa_
    complexed with edo, mg, mpo

Details for d2q3ub_

PDB Entry: 2q3u (more details), 1.53 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At5g08170, agmatine iminohydrolase
PDB Compounds: (B:) agmatine deiminase

SCOPe Domain Sequences for d2q3ub_:

Sequence, based on SEQRES records: (download)

>d2q3ub_ d.126.1.6 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
spaehgyympaewdshaqtwigwperqdnwrhnalpaqrvfagvakaiskfepvtvcasp
aqwenarkqlpedirvvemsmndswfrdsgptfivrkrpvklsslnrniagidwnfnawg
gandgcyndwshdllvsrkilaleriprfqhsmileggsihvdgegtclvteecllnknr
nphmskeqieeelkkylgvqsfiwlprglygdedtnghidnmccfarpgvvllswtddet
dpqyersvealsvlsnsidargrkiqviklyipeplymteeessgitqdgeaiprlagtr
laasyvnfyianggiiapqfgdpirdkeairvlsdtfphhsvvgienareivlaggnihc
itqqqpaept

Sequence, based on observed residues (ATOM records): (download)

>d2q3ub_ d.126.1.6 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
spaehgyympaewdshaqtwigwperqdnwrhnalpaqrvfagvakaiskfepvtvcasp
aqwenarkqlpedirvvemsmndswfrdsgptfivrkrnrniagidwnfnawggandgcy
ndwshdllvsrkilaleriprfqhsmileggsihvdgegtclvteecllnknrnphmske
qieeelkkylgvqsfiwlprglygdedtnghidnmccfarpgvvllswtddetdpqyers
vealsvlsnsidargrkiqviklyipeplymteeessgitqdgeaiprlagtrlaasyvn
fyianggiiapqfgdpirdkeairvlsdtfphhsvvgienareivlaggnihcitqqqpa
ept

SCOPe Domain Coordinates for d2q3ub_:

Click to download the PDB-style file with coordinates for d2q3ub_.
(The format of our PDB-style files is described here.)

Timeline for d2q3ub_: