SCOP 1.73: Domain d2pwzg2: 2pwz G:146-312

Lineage for d2pwzg2 (2pwz G:146-312)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)

6. Protein Malate dehydrogenase [56329] (11 species)

7. Species Escherichia coli [TaxId:562] [56333] (5 PDB entries)

8. Domain d2pwzg2: 2pwz G:146-312 [139773]
   Other proteins in same PDB: d2pwza1, d2pwzc1, d2pwze1, d2pwzg1
   automatically matched to d1emd_2

Details for d2pwzg2

PDB Entry: 2pwz, 2.2 Å

PDB Description: crystal structure of the apo form of e.coli malate dehydrogenase

PDB Compounds: (G:) malate dehydrogenase

SCOP Domain Sequences for d2pwzg2:

Sequence; same for both SEQRES and ATOM records:

>d2pwzg2 d.162.1.1 (G:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]}
vttldiirsntfvaelkgkqpgevevpvigghsgvtilpllsqvpgvsfteqevadltkr
iqnagtevveakagggsatlsmgqaaarfglslvralqgeqgvvecayvegdgqyarffs
qplllgkngveerksigtlsafeqnalegmldtlkkdialgeefvnk

Timeline for d2pwzg2:

• d2pwzg2 is new in SCOP 1.73
  
• d2pwzg2 appears in SCOP 1.75
  
• d2pwzg2 appears in the current release, SCOPe 2.08