Lineage for d2pwze2 (2pwz E:146-312)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 877107Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 877108Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 877109Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 877217Protein Malate dehydrogenase [56329] (11 species)
  7. 877274Species Escherichia coli [TaxId:562] [56333] (5 PDB entries)
  8. 877283Domain d2pwze2: 2pwz E:146-312 [139771]
    Other proteins in same PDB: d2pwza1, d2pwzc1, d2pwze1, d2pwzg1
    automatically matched to d1emd_2

Details for d2pwze2

PDB Entry: 2pwz (more details), 2.2 Å

PDB Description: crystal structure of the apo form of e.coli malate dehydrogenase
PDB Compounds: (E:) malate dehydrogenase

SCOP Domain Sequences for d2pwze2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pwze2 d.162.1.1 (E:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]}
vttldiirsntfvaelkgkqpgevevpvigghsgvtilpllsqvpgvsfteqevadltkr
iqnagtevveakagggsatlsmgqaaarfglslvralqgeqgvvecayvegdgqyarffs
qplllgkngveerksigtlsafeqnalegmldtlkkdialgeefvnk

SCOP Domain Coordinates for d2pwze2:

Click to download the PDB-style file with coordinates for d2pwze2.
(The format of our PDB-style files is described here.)

Timeline for d2pwze2: