Lineage for d2pwza1 (2pwz A:1-145)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107573Species Escherichia coli K-12 [TaxId:83333] [188668] (7 PDB entries)
  8. 2107586Domain d2pwza1: 2pwz A:1-145 [139766]
    Other proteins in same PDB: d2pwza2, d2pwzc2, d2pwze2, d2pwzg2
    automated match to d2cmda1

Details for d2pwza1

PDB Entry: 2pwz (more details), 2.2 Å

PDB Description: crystal structure of the apo form of e.coli malate dehydrogenase
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d2pwza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pwza1 c.2.1.0 (A:1-145) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
vnttvaiaaevlkkagvydknklfg

SCOPe Domain Coordinates for d2pwza1:

Click to download the PDB-style file with coordinates for d2pwza1.
(The format of our PDB-style files is described here.)

Timeline for d2pwza1: