SCOP 1.75: Domain d2pw2b1: 2pw2 B:1-113

Lineage for d2pw2b1 (2pw2 B:1-113)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (67 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831
   SQ NA # humanized antibody
   SQ NA # Humanized antibody
   SQ NA # engineered antibody
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

8. Domain d2pw2b1: 2pw2 B:1-113 [139760]
   Other proteins in same PDB: d2pw2b2
   automatically matched to d2f5ah1

Details for d2pw2b1

PDB Entry: 2pw2, 2.55 Å

PDB Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide ELDKWKSL

PDB Compounds: (B:) 2F5 Fab' light chain

SCOP Domain Sequences for d2pw2b1:

Sequence; same for both SEQRES and ATOM records:

>d2pw2b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
vwgqgitvtiss

Timeline for d2pw2b1:

• d2pw2b1 first appeared in SCOP 1.73
  
• d2pw2b1 appears in SCOPe 2.01
  
• d2pw2b1 appears in the current release, SCOPe 2.08