Lineage for d2pvva3 (2pvv A:57-117,A:351-593)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 702659Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 703083Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 703319Family c.56.5.5: FolH catalytic domain-like [53210] (2 proteins)
  6. 703320Protein Glutamate carboxypeptidase II FOLH1 [142522] (1 species)
    Folate hydrolase 1, FolH homologue
  7. 703321Species Human (Homo sapiens) [TaxId:9606] [142523] (11 PDB entries)
  8. 703326Domain d2pvva3: 2pvv A:57-117,A:351-593 [139754]
    Other proteins in same PDB: d2pvva1, d2pvva2
    automatically matched to 2C6C A:57-117,A:351-593
    complexed with ca, cl, man, nag, ose, zn

Details for d2pvva3

PDB Entry: 2pvv (more details), 2.11 Å

PDB Description: Structure of human glutamate carboxypeptidase II (GCPII) in complex with L-serine-O-sulfate
PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOP Domain Sequences for d2pvva3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pvva3 c.56.5.5 (A:57-117,A:351-593) Glutamate carboxypeptidase II FOLH1 {Human (Homo sapiens) [TaxId: 9606]}
nmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahydvl
lXevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkke
gwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctp
lmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrl
giasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfela
nsivl

SCOP Domain Coordinates for d2pvva3:

Click to download the PDB-style file with coordinates for d2pvva3.
(The format of our PDB-style files is described here.)

Timeline for d2pvva3: